| Title: | cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family |
| Author(s): | Jacquin-Joly E; Burnet M; Francois MC; Ammar D; Meillour PN; Descoins C; |
| Address: | "Unite de Phytopharmacie et des Mediateurs Chimiques, INRA, Versailles, France" |
| DOI: | 10.1016/s0965-1748(98)00017-4 |
| ISSN/ISBN: | 0965-1748 (Print) 0965-1748 (Linking) |
| Abstract: | "Sex pheromone biosynthesis in a number of moth species is induced by a conserved 33-amino acid amidated neuropeptide PBAN (pheromone biosynthesis activating neuropeptide). Here, using immunoblotting and bioassay, we present evidence for the presence of a very similar peptide, called Mab-PBAN, in the brain-subesophageal ganglion complex of Mamestra brassicae females. A partial Mab-PBAN encoding cDNA was isolated using 3'RACE. The deduced amino acid sequence for Mab-PBAN is: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL with a presumed amidated C-terminus. Mab-PBAN has high homology to the other members of the PBAN peptide family: 94% with Hez-PBAN, 87.9% with Lyd-PBAN and 78.8% with Bom-PBAN. The Mab-PBAN gene encodes, beside Mab-PBAN, at least three putative amidated peptides in the same reading frame, all of them having a common C-terminal pentapeptide motif F(T/S)P(R/K)L-NH2" |
| Keywords: | "Amino Acid Sequence Animals Brain Chemistry *Cloning, Molecular DNA, Complementary/*analysis Molecular Sequence Data Moths/*genetics Neuropeptides/*genetics Sequence Analysis, DNA *Sequence Homology, Amino Acid Sex Attractants/*genetics;" |
| Notes: | "MedlineJacquin-Joly, E Burnet, M Francois, M C Ammar, D Meillour, P N Descoins, C eng Research Support, Non-U.S. Gov't England 1998/07/31 Insect Biochem Mol Biol. 1998 Apr; 28(4):251-8. doi: 10.1016/s0965-1748(98)00017-4" |
