Bedoukian   RussellIPM   RussellIPM   Piezoelectric Micro-Sprayer


Home
Animal Taxa
Plant Taxa
Semiochemicals
Floral Compounds
Semiochemical Detail
Semiochemicals & Taxa
Synthesis
Control
Invasive spp.
References

Abstract

Guide

Alphascents
Pherobio
InsectScience
E-Econex
Counterpart-Semiochemicals
Print
Email to a Friend
Kindly Donate for The Pherobase

« Previous AbstractIdentification of PBAN-like peptides in the brain-subesophageal ganglion complex of lepidoptera using Western-blotting    Next AbstractCharacterization of the general odorant-binding protein 2 in the molecular coding of odorants in Mamestra brassicae »

Insect Biochem Mol Biol


Title:cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family
Author(s):Jacquin-Joly E; Burnet M; Francois MC; Ammar D; Meillour PN; Descoins C;
Address:"Unite de Phytopharmacie et des Mediateurs Chimiques, INRA, Versailles, France"
Journal Title:Insect Biochem Mol Biol
Year:1998
Volume:28
Issue:4
Page Number:251 - 258
DOI: 10.1016/s0965-1748(98)00017-4
ISSN/ISBN:0965-1748 (Print) 0965-1748 (Linking)
Abstract:"Sex pheromone biosynthesis in a number of moth species is induced by a conserved 33-amino acid amidated neuropeptide PBAN (pheromone biosynthesis activating neuropeptide). Here, using immunoblotting and bioassay, we present evidence for the presence of a very similar peptide, called Mab-PBAN, in the brain-subesophageal ganglion complex of Mamestra brassicae females. A partial Mab-PBAN encoding cDNA was isolated using 3'RACE. The deduced amino acid sequence for Mab-PBAN is: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL with a presumed amidated C-terminus. Mab-PBAN has high homology to the other members of the PBAN peptide family: 94% with Hez-PBAN, 87.9% with Lyd-PBAN and 78.8% with Bom-PBAN. The Mab-PBAN gene encodes, beside Mab-PBAN, at least three putative amidated peptides in the same reading frame, all of them having a common C-terminal pentapeptide motif F(T/S)P(R/K)L-NH2"
Keywords:"Amino Acid Sequence Animals Brain Chemistry *Cloning, Molecular DNA, Complementary/*analysis Molecular Sequence Data Moths/*genetics Neuropeptides/*genetics Sequence Analysis, DNA *Sequence Homology, Amino Acid Sex Attractants/*genetics;"
Notes:"MedlineJacquin-Joly, E Burnet, M Francois, M C Ammar, D Meillour, P N Descoins, C eng Research Support, Non-U.S. Gov't England 1998/07/31 Insect Biochem Mol Biol. 1998 Apr; 28(4):251-8. doi: 10.1016/s0965-1748(98)00017-4"

 
Back to top
 
Citation: El-Sayed AM 2024. The Pherobase: Database of Pheromones and Semiochemicals. <http://www.pherobase.com>.
© 2003-2024 The Pherobase - Extensive Database of Pheromones and Semiochemicals. Ashraf M. El-Sayed.
Page created on 17-11-2024