« Previous AbstractSynthesis and biological evaluation of the geometric farnesylated analogues of the a-factor mating peptide of Saccharomyces cerevisiae    Next AbstractStudy on the pathogenesis and prevention strategies of kidney stones based on GC-MS combined with metabolic pathway analysis »

Biochemistry

Title:		Synthesis and biophysical analysis of transmembrane domains of a Saccharomyces cerevisiae G protein-coupled receptor
Author(s):		Xie H; Ding FX; Schreiber D; Eng G; Liu SF; Arshava B; Arevalo E; Becker JM; Naider F;
Address:		"Department of Chemistry, The College of Staten Island Staten Island, New York 10314, USA"
Journal Title:		Biochemistry
Year:		2000
Volume:		39
Issue:		50
Page Number:		15462 - 15474
DOI:		10.1021/bi001432p
ISSN/ISBN:		0006-2960 (Print) 0006-2960 (Linking)
Abstract:		"The Ste2p receptor for alpha-factor, a tridecapeptide mating pheromone of the yeast Saccharomyces cerevisiae, belongs to the G protein-coupled family of receptors. In this paper we report on the synthesis of peptides corresponding to five of the seven transmembrane domains (M1-M5) and two homologues of the sixth transmembrane domain corresponding to the wild-type sequence and a mutant sequence found in a constitutively active receptor. The secondary structures of all new transmembrane peptides and previously synthesized peptides corresponding to domains 6 and 7 were assessed using a detailed CD analysis in trifluoroethanol, trifluoroethanol-water mixtures, sodium dodecyl sulfate micelles, and dimyristoyl phosphatidyl choline bilayers. Tryptophan fluorescence quenching experiments were used to assess the penetration of the membrane peptides into lipid bilayers. All peptides were predominantly (40-80%) helical in trifluoroethanol and most trifluoroethanol-water mixtures. In contrast, two of the peptides M3-35 (KKKNIIQVLLVASIETSLVFQIKVIFTGDNFKKKG) and M6-31 (KQFDSFHILLINleSAQSLLVPSIIFILAYSLK) formed stable beta-sheet structures in both sodium dodecyl sulfate micelles and DMPC bilayers. Polyacrylamide gel electrophoresis showed that these two peptides formed high molecular aggregates in the presence of SDS whereas all other peptides moved as monomeric species. The peptide (KKKFDSFHILLIMSAQSLLVLSIIFILAYSLKKKS) corresponding to the sequence in the constitutive mutant was predominantly helical under a variety of conditions, whereas the homologous wild-type sequence (KKKFDSFHILLIMSAQSLLVPSIIFILAYSLKKKS) retained a tendency to form beta-structures. These results demonstrate a connection between a conformational shift in secondary structure, as detected by biophysical techniques, and receptor function. The aggregation of particular transmembrane domains may also reflect a tendency for intermolecular interactions that occur in the membrane environment facilitating formation of receptor dimers or multimers"
Keywords:		"Amino Acid Sequence GTP-Binding Proteins Molecular Sequence Data Peptide Fragments/chemical synthesis/chemistry Receptors, Mating Factor Receptors, Peptide/*chemistry Saccharomyces cerevisiae Signal Transduction Transcription Factors/chemistry;"
Notes:		"MedlineXie, H Ding, F X Schreiber, D Eng, G Liu, S F Arshava, B Arevalo, E Becker, J M Naider, F eng GM22086/GM/NIGMS NIH HHS/ GM22087/GM/NIGMS NIH HHS/ Research Support, Non-U.S. Gov't Research Support, U.S. Gov't, P.H.S. 2000/12/12 Biochemistry. 2000 Dec 19; 39(50):15462-74. doi: 10.1021/bi001432p"